Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PILR-alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP255310
Description
PILR-alpha Polyclonal specifically detects PILR-alpha in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PILR-alpha | |
Polyclonal | |
Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Cell surface receptor FDF03, FDF03, inhibitory receptor PILRalpha, Inhibitory receptor PILR-alpha, paired immunoglobin-like receptor alpha, paired immunoglobin-like type 2 receptor alpha, paired immunoglobulin-like receptor alpha, paired immunoglobulin-like type 2 receptor alpha | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
PILRA | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALSSSTSPRAPPSHRPLKSPQNETLYSVLK | |
100 μL | |
Signal Transduction | |
29992 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction