Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PILR-alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $648.50
Specifications
Antigen | PILR-alpha |
---|---|
Dilution | Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Applications | Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
PILR-alpha Polyclonal specifically detects PILR-alpha in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PILR-alpha | |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
Cell surface receptor FDF03, FDF03, inhibitory receptor PILRalpha, Inhibitory receptor PILR-alpha, paired immunoglobin-like receptor alpha, paired immunoglobin-like type 2 receptor alpha, paired immunoglobulin-like receptor alpha, paired immunoglobulin-like type 2 receptor alpha | |
PILRA | |
IgG | |
Affinity Purified |
Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
29992 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALSSSTSPRAPPSHRPLKSPQNETLYSVLK | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title