PILR-alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP16009520UL

Catalog No. NBP16009520

Description

PILR-alpha Polyclonal specifically detects PILR-alpha in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PILR-alpha
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q9UKJ1-4
• Gene Symbols: PILRA
• Immunogen: Synthetic peptides corresponding to PILRA(paired immunoglobin-like type 2 receptor alpha) The peptide sequence was selected from the N terminal of PILRA. Peptide sequence IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLN.
• Quantity: 20 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 29992
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cell surface receptor FDF03, FDF03, inhibitory receptor PILRalpha, Inhibitory receptor PILR-alpha, paired immunoglobin-like receptor alpha, paired immunoglobin-like type 2 receptor alpha, paired immunoglobulin-like receptor alpha, paired immunoglobulin-like type 2 receptor alpha
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG