PIMT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154942

Catalog No. NBP154942

Description

PIMT Polyclonal specifically detects PIMT in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PIMT
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cap-specific guanine-N2 methyltransferase, CLL-associated antigen KW-2, DKFZp762A163, EC 2.1.1, EC 2.1.1.-, HCA137, Hepatocellular carcinoma-associated antigen 137, NCOA6IPSEREX-defined, nuclear receptor coactivator 6 interacting protein, Nuclear receptor coactivator 6-interacting protein, PIMTFLJ22995, PIPMT, PRIP-interacting protein PIPMT, PRIP-interacting protein with methyltransferase domain, PRIP-interacting protein with methyltransferase motif, trimethylguanosine synthase, trimethylguanosine synthase 1, trimethylguanosine synthase homolog, trimethylguanosine synthase homolog (S. cerevisiae)
• Host Species: Rabbit
• Molecular Weight of Antigen: 96 kDa
• Quantity: 100 μL
• Research Discipline: Transcription Factors and Regulators
• Gene ID (Entrez): 96764
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96RS0
• Gene Symbols: TGS1
• Immunogen: Synthetic peptides corresponding to TGS1(trimethylguanosine synthase homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of TGS1. Peptide sequence IDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKY.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.