Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIMT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PIMT |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PIMT Polyclonal specifically detects PIMT in Human samples. It is validated for Western Blot.Specifications
PIMT | |
Polyclonal | |
Rabbit | |
Transcription Factors and Regulators | |
Cap-specific guanine-N2 methyltransferase, CLL-associated antigen KW-2, DKFZp762A163, EC 2.1.1, EC 2.1.1.-, HCA137, Hepatocellular carcinoma-associated antigen 137, NCOA6IPSEREX-defined, nuclear receptor coactivator 6 interacting protein, Nuclear receptor coactivator 6-interacting protein, PIMTFLJ22995, PIPMT, PRIP-interacting protein PIPMT, PRIP-interacting protein with methyltransferase domain, PRIP-interacting protein with methyltransferase motif, trimethylguanosine synthase, trimethylguanosine synthase 1, trimethylguanosine synthase homolog, trimethylguanosine synthase homolog (S. cerevisiae) | |
TGS1 | |
IgG | |
96 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q96RS0 | |
96764 | |
Synthetic peptides corresponding to TGS1(trimethylguanosine synthase homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of TGS1. Peptide sequence IDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKY. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title