PIN4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP152995

Catalog No. NBP152995

Description

PIN4 Polyclonal specifically detects PIN4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PIN4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 4 (parvulin), MGC138486, Parvulin-17, protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)
• Host Species: Rabbit
• Molecular Weight of Antigen: 16 kDa
• Quantity: 100 μL
• Research Discipline: metabolism
• Gene ID (Entrez): 5303
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9Y237-2
• Gene Symbols: PIN4
• Immunogen: Synthetic peptides corresponding to PIN4(protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin)) The peptide sequence was selected from the middle region of PIN4. Peptide sequence LGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.