Learn More
Description
Specifications
Specifications
| Antigen | Pirh2 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | Androgen receptor N-terminal-interacting protein, androgen-receptor N-terminal-interacting protein, ARNIPRING finger protein 199, CHIMPRNF199DKFZp586C1620, CH-rich interacting match with PLAG1, CH-rich-interacting match with PLAG1, E3 ubiquitin-protein ligase Pirh2, EC 6.3.2.-, hARNIP, hPirh2, PIRH2, PRO1996, ring finger and CHY zinc finger domain containing 1, RING finger and CHY zinc finger domain-containing protein 1, Zinc finger protein 363p53-induced RING-H2 protein, ZNF363 |
| Gene Symbols | RCHY1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:CDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHL |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
