Pirh2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP190098

Catalog No. NBP190098

Description

Pirh2 Polyclonal specifically detects Pirh2 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Pirh2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: Androgen receptor N-terminal-interacting protein, androgen-receptor N-terminal-interacting protein, ARNIPRING finger protein 199, CHIMPRNF199DKFZp586C1620, CH-rich interacting match with PLAG1, CH-rich-interacting match with PLAG1, E3 ubiquitin-protein ligase Pirh2, EC 6.3.2.-, hARNIP, hPirh2, PIRH2, PRO1996, ring finger and CHY zinc finger domain containing 1, RING finger and CHY zinc finger domain-containing protein 1, Zinc finger protein 363p53-induced RING-H2 protein, ZNF363
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RCHY1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:CDICHLFDKDKKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHL
• Quantity: 0.1 mL
• Research Discipline: Apoptosis, Breast Cancer, Cancer, p53 Pathway, Tumor Suppressors, Ubiquitin Proteasome Pathway, Zinc Finger
• Gene ID (Entrez): 25898
• Target Species: Human
• Isotype: IgG

For Research Use Only