Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PKA 2 beta Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP31775325UL
This item is not returnable.
View return policy
Description
PKA 2 beta Polyclonal antibody specifically detects PKA 2 beta in Human samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
PKA 2 beta | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
cAMP-dependent protein kinase type II-beta regulatory chain, cAMP-dependent protein kinase type II-beta regulatory subunit, H_RG363E19.2, PRKAR2, protein kinase, cAMP-dependent, regulatory, type II, beta, RII-BETA, WUGSC:H_RG363E19.2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: LKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEI | |
25 μg | |
Signal Transduction | |
5577 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction