PKC beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25492825UL

Catalog No. NB404084

Description

PKC beta Polyclonal specifically detects PKC beta in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PKC beta
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: EC 2.7.11, EC 2.7.11.13, MGC41878, PKC-B, PKC-beta, PKCBPRKCB2, PRKCB1protein kinase C beta 1, protein kinase C beta type, protein kinase C, beta, protein kinase C, beta 1, protein kinase C, beta 1 polypeptide
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PRKCB
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTD
• Quantity: 25 μL
• Research Discipline: Cancer, mTOR Pathway, Protein Kinase, Signal Transduction, Wnt Signaling Pathway
• Gene ID (Entrez): 5579
• Target Species: Human
• Isotype: IgG

For Research Use Only