Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PKC beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | PKC beta |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PKC beta Polyclonal specifically detects PKC beta in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
PKC beta | |
Polyclonal | |
Rabbit | |
Cancer, mTOR Pathway, Protein Kinase, Signal Transduction, Wnt Signaling Pathway | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
5579 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTD | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
EC 2.7.11, EC 2.7.11.13, MGC41878, PKC-B, PKC-beta, PKCBPRKCB2, PRKCB1protein kinase C beta 1, protein kinase C beta type, protein kinase C, beta, protein kinase C, beta 1, protein kinase C, beta 1 polypeptide | |
PRKCB | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title