Learn More
Description
Specifications
Specifications
| Antigen | PKC beta |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | EC 2.7.11, EC 2.7.11.13, MGC41878, PKC-B, PKC-beta, PKCBPRKCB2, PRKCB1protein kinase C beta 1, protein kinase C beta type, protein kinase C, beta, protein kinase C, beta 1, protein kinase C, beta 1 polypeptide |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PKC beta1 (NP_002729.2). Peptide sequence KPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEF |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
