Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PKC gamma Antibody, Novus Biologicals™
SDP

Catalog No. NBP158916 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP158916 100 μL
NBP15891620 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP158916 Supplier Novus Biologicals Supplier No. NBP158916
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

PKC gamma Polyclonal specifically detects PKC gamma in Human, Mouse samples. It is validated for Western Blot, ChIP assay.

Specifications

Antigen PKC gamma
Applications Western Blot, ChIP Assay
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation (ChIP) 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P05129
Gene Alias EC 2.7.11, EC 2.7.11.13, MGC57564, PKCCSCA14, PKC-gamma, PKCGprotein kinase C gamma type, protein kinase C, gamma
Gene Symbols PRKCG
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PRKCG(protein kinase C, gamma) The peptide sequence was selected from the N terminal of PRKCG. Peptide sequence FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Protein Kinase, Signal Transduction, Wnt Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 5582
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Rabbit: 100%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.