PKC iota Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258629

Catalog No. NBP258629

Description

PKC iota Polyclonal specifically detects PKC iota in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PKC iota
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: aPKC-lambda/iota, Atypical protein kinase C-lambda/iota, DXS1179E, EC 2.7.11, EC 2.7.11.13, MGC26534, nPKC-iota, PKCI, PRKC-lambda/iota, protein kinase C iota type, protein kinase C, iota
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PRKCI
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:STMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLEL
• Quantity: 100 μL
• Research Discipline: Protein Kinase, Signal Transduction
• Gene ID (Entrez): 5584
• Target Species: Human
• Isotype: IgG

For Research Use Only