Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PKC iota Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | PKC iota |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PKC iota Polyclonal specifically detects PKC iota in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
PKC iota | |
Polyclonal | |
Rabbit | |
Protein Kinase, Signal Transduction | |
aPKC-lambda/iota, Atypical protein kinase C-lambda/iota, DXS1179E, EC 2.7.11, EC 2.7.11.13, MGC26534, nPKC-iota, PKCI, PRKC-lambda/iota, protein kinase C iota type, protein kinase C, iota | |
PRKCI | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
5584 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:STMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLEL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title