PKC theta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25571725UL

Catalog No. NB394860

Description

PKC theta Polyclonal antibody specifically detects PKC theta in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: PKC theta
• Classification: Polyclonal
• Dilution: Western Blot -Reported in scientific literature (PMID:34073294), Immunocytochemistry/ Immunofluorescence 0.25-2 μg/ml
• Gene Alias: EC 2.7.11, EC 2.7.11.13, MGC126514, MGC141919, nPKC-theta, PRKCT, protein kinase C theta type, protein kinase C, theta
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQK
• Quantity: 25 μL
• Research Discipline: Protein Kinase, Signal Transduction
• Gene ID (Entrez): 5588
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified