Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PKC theta Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00
Specifications
| Antigen | PKC theta |
|---|---|
| Dilution | Western Blot -Reported in scientific literature (PMID:34073294), Immunocytochemistry/ Immunofluorescence 0.25-2 μg/ml |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
PKC theta Polyclonal antibody specifically detects PKC theta in Human, Mouse samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
| PKC theta | |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Protein Kinase, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol | |
| 5588 | |
| IgG | |
| Affinity purified |
| Western Blot -Reported in scientific literature (PMID:34073294), Immunocytochemistry/ Immunofluorescence 0.25-2 μg/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| EC 2.7.11, EC 2.7.11.13, MGC126514, MGC141919, nPKC-theta, PRKCT, protein kinase C theta type, protein kinase C, theta | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQK | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title