PKLR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258892

Catalog No. NBP258892

Description

PKLR Polyclonal specifically detects PKLR in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PKLR
• Classification: Polyclonal
• Dilution: Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: EC 2.7.1.40, PK1PKRL, PKL, PKR, Pyruvate kinase 1, pyruvate kinase isozyme R/L, pyruvate kinase isozymes R/L, pyruvate kinase type L, pyruvate kinase, liver and blood cell, pyruvate kinase, liver and RBC, Red cell/liver pyruvate kinase, RPK, R-type/L-type pyruvate kinase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PKLR
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSPLSYRPVAIALDTKGPEIRTGILQGGPESEVELVKGSQVLVTVDPAFRTRGNANTVWVDYPNIVRVVPVGGRIYIDDGLISLVVQKIGPEGLVTQVENGGVLGSRKGVNLPGA
• Quantity: 100 μL
• Research Discipline: Chaperone Mediated Autophagy (CMA), Lipid and Metabolism, Signal Transduction
• Gene ID (Entrez): 5313
• Target Species: Human
• Isotype: IgG

For Research Use Only