PLA1A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25859925UL

Catalog No. NB393370

Description

PLA1A Polyclonal specifically detects PLA1A in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PLA1A
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: EC 3.1.1, EC 3.1.1.-, NMD, phosphatidylserine-specific phospholipase A1alpha, phospholipase A1 member A, PS-PLA1, PSPLA1Phosphatidylserine-specific phospholipase A1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51365
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PLA1A
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QCQINQVKFKFQSSNRVWKKDRTTIIGKFCTALLPVNDREKMVCLPEPVNLQASVTVSCDLKIAC
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only