PLA2G4B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180112

Catalog No. NBP180112

Description

PLA2G4B Polyclonal specifically detects PLA2G4B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PLA2G4B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ20543, FLJ20656, FLJ20807, FLJ77014, FLJ78330, jmjC domain-containing protein 7, jumonji domain containing 7, Jumonji domain-containing protein 7
• Host Species: Rabbit
• Molecular Weight of Antigen: 114 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 8681
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_005081
• Gene Symbols: JMJD7-PLA2G4B
• Immunogen: Synthetic peptide directed towards the N terminal of human PLA2G4B. Peptide sequence: KDHYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVD
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Bovine: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG