Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PLA2G4B Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$499.50

Specifications

Antigen PLA2G4B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP180112
SDP
View Documents
Novus Biologicals
NBP180112
100 μL
Each of 1 for $499.50
Only null left
Add to Cart
 
Description

Description

PLA2G4B Polyclonal specifically detects PLA2G4B in Human samples. It is validated for Western Blot.
Specifications

Specifications

PLA2G4B
Polyclonal
Rabbit
Signal Transduction
FLJ20543, FLJ20656, FLJ20807, FLJ77014, FLJ78330, jmjC domain-containing protein 7, jumonji domain containing 7, Jumonji domain-containing protein 7
JMJD7-PLA2G4B
IgG
114 kDa
Western Blot
Unconjugated
RUO
NP_005081
8681
Synthetic peptide directed towards the N terminal of human PLA2G4B. Peptide sequence: KDHYENLYCVVSGEKHFLFHPPSDRPFIPYELYTPATYQLTEEGTFKVVD
Primary
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.