Placental Lactogen/CSH1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP254710

Catalog No. NBP254710

Description

Placental Lactogen/CSH1 Polyclonal specifically detects Placental Lactogen/CSH1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Placental Lactogen/CSH1
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: Choriomammotropin, chorionic somatomammotropin hormone, chorionic somatomammotropin hormone 1 (placental lactogen), CS-1, CSAchorionic somatomammotropin A, CSH2, CSMT, FLJ75407, hCS-A, Lactogen, Placental lactogen, PLchoriomammotropin
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CSH1
• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:SHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGF
• Quantity: 100 μL
• Research Discipline: Cytokine Research, Signal Transduction
• Gene ID (Entrez): 1442
• Target Species: Human
• Isotype: IgG

For Research Use Only