Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Plasma Kallikrein/KLKB1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP158978 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP158978 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP158978 Supplier Novus Biologicals Supplier No. NBP158978

Rabbit Polyclonal Antibody

Plasma Kallikrein/KLKB1 Polyclonal specifically detects Plasma Kallikrein/KLKB1 in Human samples. It is validated for Western Blot.

Specifications

Antigen Plasma Kallikrein/KLKB1
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P03952
Gene Alias EC 3.4.21, EC 3.4.21.34, Fletcher factor, kallikrein B, plasma (Fletcher factor) 1, kininogenin, KLK3plasma kallikrein, plasma kallikrein heavy chain, plasma kallikrein light chain, Plasma prekallikrein, PPK
Gene Symbols KLKB1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to KLKB1(kallikrein B, plasma (Fletcher factor) 1) The peptide sequence was selected from the middle region of KLKB1. Peptide sequence VLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVS.
Molecular Weight of Antigen 28 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 3818
Test Specificity Expected identity based on immunogen sequence: Rat: 79%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Rat, Pig, Canine, Equine
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.