PLCD4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238393

Catalog No. NBP238393

Description

PLCD4 Polyclonal specifically detects PLCD4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PLCD4
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: Q9BRC7
• Gene Symbols: PLCD4
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GFTIVFHGRRSNLDLMANSVEEAQIWMRGLQLLVDLVTSMDHQERLDQWLSDWFQRGDKNQDGKMSFQEVQRLLH
• Quantity: 0.1 mL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 84812
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 3.1.4.11, hPLCD4, MGC12837, Phosphoinositide phospholipase C-delta-4, phospholipase C, delta 4, Phospholipase C-delta-4, PLC delta4, PLC-delta-4,1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta-4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.