Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PLCH2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP26894525UL
Description
PLCH2 Polyclonal antibody specifically detects PLCH2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
PLCH2 | |
Polyclonal | |
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase eta-2, KIAA0450, phosphoinositide phospholipase C-eta-2, phosphoinositide phospholipase C-like 4, phospholipase C, eta 2, phospholipase C-eta-2 | |
This antibody was developed against a recombinant protein corresponding to amino acids: AEEDVESGEDAGASRRNGRLVVGSFSRRKKKGSKLKKAASVEEGDEGQDSPGGQSRGATRQKKTMKLSR | |
25 μL | |
Primary | |
Human | |
Purified |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol | |
Rabbit | |
Protein A purified | |
RUO | |
9651 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction