Learn More
Description
Specifications
Specifications
| Antigen | PLK4 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | EC 2.7.11.21, PLK-4, polo-like kinase 4 (Drosophila), polo-like kinase 4SAKSTK18serine/threonine kinase 18, Sak, serine/threonine protein kinase SAK, Serine/threonine-protein kinase 18, serine/threonine-protein kinase PLK4, Serine/threonine-protein kinase Sak, Snk akin kinase |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: CLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFSNPTP |
| Purification Method | Protein A purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
