Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PLK4 Antibody, Novus Biologicals™

PLK4 Antibody, Novus Biologicals™
SDP

Catalog No. NB392977 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB392977 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB392977 Supplier Novus Biologicals Supplier No. NBP26865025UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PLK4 Polyclonal antibody specifically detects PLK4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen PLK4
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias EC 2.7.11.21, PLK-4, polo-like kinase 4 (Drosophila), polo-like kinase 4SAKSTK18serine/threonine kinase 18, Sak, serine/threonine protein kinase SAK, Serine/threonine-protein kinase 18, serine/threonine-protein kinase PLK4, Serine/threonine-protein kinase Sak, Snk akin kinase
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: CLPKSAQLLKSVFVKNVGWATQLTSGAVWVQFNDGSQLVVQAGVSSISYTSPNGQTTRYGENEKLPDYIKQKLQCLSSILLMFSNPTP
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication, Core ESC Like Genes, Mitotic Regulators, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 10733
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.