PMCA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159426

Catalog No. NBP159426

Description

PMCA3 Polyclonal specifically detects PMCA3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PMCA3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ATPase, Ca++ transporting, plasma membrane 3, EC 3.6.3, EC 3.6.3.8, plasma membrane calcium ATPase, Plasma membrane calcium ATPase isoform 3, Plasma membrane calcium pump isoform 3, plasma membrane calcium-transporting ATPase 3, PMCA3a, PMCA3plasma membrane calcium pump
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 492
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q16720
• Gene Symbols: ATP2B3
• Immunogen: Synthetic peptides corresponding to ATP2B3(ATPase, Ca++ transporting, plasma membrane 3) The peptide sequence was selected from the N terminal of ATP2B3. Peptide sequence GDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Pig: 92%; Guinea pig: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG