Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PMCA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PMCA3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PMCA3 Polyclonal specifically detects PMCA3 in Human samples. It is validated for Western Blot.Specifications
PMCA3 | |
Polyclonal | |
Rabbit | |
Q16720 | |
492 | |
Synthetic peptides corresponding to ATP2B3(ATPase, Ca++ transporting, plasma membrane 3) The peptide sequence was selected from the N terminal of ATP2B3. Peptide sequence GDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
ATPase, Ca++ transporting, plasma membrane 3, EC 3.6.3, EC 3.6.3.8, plasma membrane calcium ATPase, Plasma membrane calcium ATPase isoform 3, Plasma membrane calcium pump isoform 3, plasma membrane calcium-transporting ATPase 3, PMCA3a, PMCA3plasma membrane calcium pump | |
ATP2B3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title