PMM1/Phosphomannomutase 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155475

Catalog No. NBP155475

Description

PMM1/Phosphomannomutase 1 Polyclonal specifically detects PMM1/Phosphomannomutase 1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PMM1/Phosphomannomutase 1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: brain glucose-1,6-bisphosphatase, EC 5.4.2.8, phosphomannomutase 1, PMM 1, PMMH22, PMMH-22, Sec53
• Host Species: Rabbit
• Molecular Weight of Antigen: 30 kDa
• Quantity: 100 μL
• Research Discipline: Proteases & Other Enzymes
• Gene ID (Entrez): 5372
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q92871
• Gene Symbols: PMM1
• Immunogen: Synthetic peptides corresponding to PMM1/Phosphomannomutase 1. The peptide sequence was selected from the N terminal of PMM1/Phosphomannomutase 1. Peptide sequence MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Zebrafish 79%, Yeast 86%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG