Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PMM1/Phosphomannomutase 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PMM1/Phosphomannomutase 1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PMM1/Phosphomannomutase 1 Polyclonal specifically detects PMM1/Phosphomannomutase 1 in Human samples. It is validated for Western Blot.Specifications
PMM1/Phosphomannomutase 1 | |
Polyclonal | |
Rabbit | |
Q92871 | |
5372 | |
Synthetic peptides corresponding to PMM1/Phosphomannomutase 1. The peptide sequence was selected from the N terminal of PMM1/Phosphomannomutase 1. Peptide sequence MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
brain glucose-1,6-bisphosphatase, EC 5.4.2.8, phosphomannomutase 1, PMM 1, PMMH22, PMMH-22, Sec53 | |
PMM1 | |
IgG | |
30 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title