Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PMP70 Antibody, Novus Biologicals™

PMP70 Antibody, Novus Biologicals™
SDP

Catalog No. NB436282 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB436282 25 μL
NBP238199 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB436282 Supplier Novus Biologicals Supplier No. NBP23819925UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PMP70 Polyclonal specifically detects PMP70 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen PMP70
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. P28288
Gene Alias 70 kDa peroxisomal membrane protein, ABC43, ATP-binding cassette, sub-family D (ALD), member 3, peroxisomal membrane protein 1 (70kD, Zellweger syndrome), Peroxisomal membrane protein-1 (70kD), PMP70ATP-binding cassette sub-family D member 3, PXMP1dJ824O18.1 (ATP-binding cassette, sub-family D (ALD), member 3 (PMP70, PXMP1)), ZWS2
Gene Symbols ABCD3
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: MVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLATPNGDVLIRDLNFEVRSGANVLICGP
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline ABC Transporters, Cellular Markers, Lipid and Metabolism, Neuroscience, Peroxisome Markers, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5825
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.