PMS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25836825UL

Catalog No. NB393486

Description

PMS1 Polyclonal specifically detects PMS1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PMS1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: DKFZp781M0253, FLJ98259, HNPCC3, hPMS1, human homolog of yeast mutL, mismatch repair gene PMSL1, PMS1 postmeiotic segregation increased 1 (S. cerevisiae), PMS1 protein homolog 1, PMSL1DNA mismatch repair protein PMS1, postmeiotic segregation increased (S. cerevisiae) 1, rhabdomyosarcoma antigen MU-RMS-40.10B, rhabdomyosarcoma antigen MU-RMS-40.10E
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PMS1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ESVLIALENLMTTCYGPLPSTNSYENNKTDVSAADIVLSKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGHCSS
• Quantity: 25 μL
• Research Discipline: DNA Repair, Mismatch Repair, Ovarian Carcinoma Cell Markers
• Gene ID (Entrez): 5378
• Target Species: Human
• Isotype: IgG

For Research Use Only