Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PMS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	PMS1
Applications	Immunocytochemistry, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP258368 View Documents View Product Certificates	Novus Biologicals NBP258368	100 μL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB393486 View Documents View Product Certificates	Novus Biologicals NBP25836825UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

PMS1 Polyclonal specifically detects PMS1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	PMS1
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	DNA Repair, Mismatch Repair, Ovarian Carcinoma Cell Markers
Gene Alias	DKFZp781M0253, FLJ98259, HNPCC3, hPMS1, human homolog of yeast mutL, mismatch repair gene PMSL1, PMS1 postmeiotic segregation increased 1 (S. cerevisiae), PMS1 protein homolog 1, PMSL1DNA mismatch repair protein PMS1, postmeiotic segregation increased (S. cerevisiae) 1, rhabdomyosarcoma antigen MU-RMS-40.10B, rhabdomyosarcoma antigen MU-RMS-40.10E
Gene Symbols	PMS1
Isotype	IgG
Purification Method	Affinity Purified

Applications	Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene ID (Entrez)	5378
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ESVLIALENLMTTCYGPLPSTNSYENNKTDVSAADIVLSKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGHCSS
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

PMS1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents