PNKD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP18834725UL

Catalog No. NB418155

Description

PNKD Polyclonal specifically detects PNKD in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: PNKD
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockdown Validated
• Gene Alias: BRP17FKSG19, DKFZp564N1362, DYT8paroxysmal nonkinesiogenic dyskinesia, FPD1brain protein 17, KIAA1184Myofibrillogenesis regulator 1, KIPP1184probable hydrolase PNKD, MGC31943, MR1Paroxysmal nonkinesiogenic dyskinesia protein, MR-1Trans-activated by hepatitis C virus core protein 2, paroxysmal nonkinesigenic dyskinesia, PDCEC 3.-, TAHCCP2PKND1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 25953
• Target Species: Human, Mouse
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PNKD
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GATANKASHNRTRALQSHSSPEGKEEPEPLSPELEYIPRKRGKNPMKA
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only