Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ PNMA6A Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

$230.50

Specifications

Product Type Recombinant Protein Antigen
Recombinant Yes
Regulatory Status RUO
Storage Requirements Store at −20°C short term. Avoid freeze-thaw cycles.
Gene Symbol PNMA6A
View More Specs

Products 2
Catalog Number Mfr. No. Protein Length Price Quantity & Availability  
Catalog Number Mfr. No. Protein Length Price Quantity & Availability  
NBP246708X View Documents Novus Biologicals™
NBP246708PEP
GPWNVVFVPRCSGEEFLGLGRVFHFPEQEGQMVESVAGALGVGLRRVCWLRSIGQAVQPWVEAVRCQSLGVF Each for $230.50
Add to cart
 
NBP246800X View Documents Novus Biologicals™
NBP246800PEP
IPEDCDDAEFQESLEAALRPMGHFTVLGKAFREEDNATAALVELDREVN Each for $230.50
Add to cart
 
Description

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PNMA6A The PNMA6A Recombinant Protein Antigen is derived from E. coli. The PNMA6A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications

Specifications

Recombinant Protein Antigen
RUO
PNMA6A
PNMA6A Recombinant Protein Antigen
Human
AC
26 kDa
Yes
Store at −20°C short term. Avoid freeze-thaw cycles.
MA6, MGC15827, paraneoplastic antigen like 6A, PNMA6
PBS and 1M Urea, pH 7.4
E.coli
Unlabeled

For Research Use Only.

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit