Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PNPLA5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17067920UL
Description
PNPLA5 Polyclonal specifically detects PNPLA5 in Human samples. It is validated for Western Blot.Specifications
PNPLA5 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
dJ388M5, dJ388M5.4, GS2L, patatin-like phospholipase domain containing 5, patatin-like phospholipase domain-containing protein 5 | |
Rabbit | |
Protein A purified | |
RUO | |
150379 | |
Store at -20C. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
PNPLA5 | |
Synthetic peptides corresponding to PNPLA5(patatin-like phospholipase domain containing 5) The peptide sequence was selected from the N terminal of PNPLA5. Peptide sequence LSLSILHPAYAPIEHVKQQLQDALPPDAHVLASQRLGISLTRWPDGRNFL. | |
20 μL | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction