Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PNPLA5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | PNPLA5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17067920
|
Novus Biologicals
NBP17067920UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP170679
|
Novus Biologicals
NBP170679 |
100 μL |
Each for $487.50
|
|
|||||
Description
PNPLA5 Polyclonal specifically detects PNPLA5 in Human samples. It is validated for Western Blot.Specifications
| PNPLA5 | |
| Polyclonal | |
| Purified | |
| RUO | |
| dJ388M5, dJ388M5.4, GS2L, patatin-like phospholipase domain containing 5, patatin-like phospholipase domain-containing protein 5 | |
| PNPLA5 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| 150379 | |
| Synthetic peptides corresponding to PNPLA5(patatin-like phospholipase domain containing 5) The peptide sequence was selected from the N terminal of PNPLA5. Peptide sequence LSLSILHPAYAPIEHVKQQLQDALPPDAHVLASQRLGISLTRWPDGRNFL. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title