Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PNPLA5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | PNPLA5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17067920
|
Novus Biologicals
NBP17067920UL |
20 μL |
Each for $152.22
|
|
NBP170679
|
Novus Biologicals
NBP170679 |
100 μL |
Each for $436.00
|
|
Description
PNPLA5 Polyclonal specifically detects PNPLA5 in Human samples. It is validated for Western Blot.Specifications
| PNPLA5 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 150379 | |
| Synthetic peptides corresponding to PNPLA5(patatin-like phospholipase domain containing 5) The peptide sequence was selected from the N terminal of PNPLA5. Peptide sequence LSLSILHPAYAPIEHVKQQLQDALPPDAHVLASQRLGISLTRWPDGRNFL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| dJ388M5, dJ388M5.4, GS2L, patatin-like phospholipase domain containing 5, patatin-like phospholipase domain-containing protein 5 | |
| PNPLA5 | |
| IgG | |
| Protein A purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title