PNUTS/PPP1R10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23856525UL

Catalog No. NB396761

Description

PNUTS/PPP1R10 Polyclonal specifically detects PNUTS/PPP1R10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PNUTS/PPP1R10
• Classification: Polyclonal
• Dilution: Western Blot 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q96QC0
• Gene Symbols: PPP1R10
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TAPSHAKFRSTGLELETPSLVPVKKNASTVVVSDKYNLKPIPLKRQSNVAAPGDATPPAEKKYKPLNTTPNATKEIKVKIIPPQPMEGLGFLDAL
• Quantity: 25 μL
• Research Discipline: Cellular Markers, Protein Phosphatase
• Gene ID (Entrez): 5514
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CAT53, FB19PP1-binding protein of 114 kDa, MHC class I region proline-rich protein CAT53, p99, Phosphatase 1 nuclear targeting subunit, phosphatase nuclear targeting subunit, PNUTSPP1R10, Protein FB19, protein phosphatase 1 regulatory subunit 10, protein phosphatase 1, regulatory (inhibitor) subunit 10, protein phosphatase 1, regulatory subunit 10, serine/threonine-protein phosphatase 1 regulatory subunit 10
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.