POLR2D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256784

Catalog No. NBP256784

Description

POLR2D Polyclonal specifically detects POLR2D in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: POLR2D
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: DNA-directed RNA polymerase II 16 kDa polypeptide, DNA-directed RNA polymerase II subunit D, DNA-directed RNA polymerase II subunit RPB4, HSRBP4, HSRPB4, polymerase (RNA) II (DNA directed) polypeptide D, RBP4, RNA polymerase II 16 kDa subunit, RNA polymerase II subunit B4, RNA polymerase II subunit hsRBP4, RPB16
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: POLR2D
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 5433
• Target Species: Human
• Isotype: IgG

For Research Use Only