Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POLR2E Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP257185
Description
POLR2E Polyclonal specifically detects POLR2E in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
POLR2E | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
DNA directed RNA polymerase II 23 kda polypeptide, DNA-directed RNA polymerase II 23 kDa polypeptide, DNA-directed RNA polymerase II subunit E, DNA-directed RNA polymerases I, II, and III subunit RPABC1, hRPB25, hsRPB5, polymerase (RNA) II (DNA directed) polypeptide E (25kD), polymerase (RNA) II (DNA directed) polypeptide E, 25kDa, RPABC1, RPB5, RPB5 homolog, XAP4RNA polymerases I, II, and III subunit ABC1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
POLR2E | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVARYFGIKRGQVVKIIRPSETAGRY | |
100 μL | |
DNA replication Transcription Translation and Splicing | |
5434 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction