POLR2J Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24669725UL

Catalog No. NB396354

Description

POLR2J Polyclonal antibody specifically detects POLR2J in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: POLR2J
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P52435
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Gene Alias: DNA-directed RNA polymerase II subunit J-1, DNA-directed RNA polymerase II subunit RPB11-a, hRPB14, MGC71910, POLR2J1RNA polymerase II subunit B11-a, polymerase (RNA) II (DNA directed) polypeptide J (13.3kD), polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa, RNA polymerase II 13.3 kDa subunit, RPB11, RPB11A, RPB11m
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: DPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFR
• Quantity: 25 μL
• Research Discipline: Neurodegeneration, Neuroscience
• Gene ID (Entrez): 5439
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG