Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. POLR2J Antibody, Novus Biologicals™

POLR2J Antibody, Novus Biologicals™
SDP

Catalog No. NB396354 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396354 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB396354 Supplier Novus Biologicals Supplier No. NBP24669725UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

POLR2J Polyclonal antibody specifically detects POLR2J in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen POLR2J
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS (pH 7.2), 40% Glycerol
Gene Accession No. P52435
Gene Alias DNA-directed RNA polymerase II subunit J-1, DNA-directed RNA polymerase II subunit RPB11-a, hRPB14, MGC71910, POLR2J1RNA polymerase II subunit B11-a, polymerase (RNA) II (DNA directed) polypeptide J (13.3kD), polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa, RNA polymerase II 13.3 kDa subunit, RPB11, RPB11A, RPB11m
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: DPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFR
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Neurodegeneration, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 5439
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.