Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POLR2J Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00
Specifications
| Antigen | POLR2J |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
POLR2J Polyclonal antibody specifically detects POLR2J in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| POLR2J | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Neurodegeneration, Neuroscience | |
| PBS (pH 7.2), 40% Glycerol | |
| DNA-directed RNA polymerase II subunit J-1, DNA-directed RNA polymerase II subunit RPB11-a, hRPB14, MGC71910, POLR2J1RNA polymerase II subunit B11-a, polymerase (RNA) II (DNA directed) polypeptide J (13.3kD), polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa, RNA polymerase II 13.3 kDa subunit, RPB11, RPB11A, RPB11m | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: DPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFR | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| P52435 | |
| 5439 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title