POLR3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP153051

Catalog No. NBP153051

Description

POLR3A Polyclonal specifically detects POLR3A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: POLR3A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DNA-directed RNA polymerase III largest subunit, DNA-directed RNA polymerase III subunit A, DNA-directed RNA polymerase III subunit RPC1, EC 2.7.7.6, hRPC155, POL3A, polymerase (RNA) III (DNA directed) polypeptide A, 155kDa, RNA polymerase III 155 kDa subunit, RNA polymerase III subunit C160, RNA polymerase III subunit RPC155-D, RPC1, RPC155RNA polymerase III subunit C1
• Host Species: Rabbit
• Molecular Weight of Antigen: 156 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: RPC1.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O14802
• Gene Symbols: POLR3A
• Immunogen: Synthetic peptides corresponding to POLR3A(polymerase (RNA) III (DNA directed) polypeptide A, 155 kDa) The peptide sequence was selected from the middle region of POLR3A (NP_008986). Peptide sequence AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11128
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.