Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POLR3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15305120UL
Description
POLR3A Polyclonal specifically detects POLR3A in Human samples. It is validated for Western Blot.Specifications
POLR3A | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
O14802 | |
POLR3A | |
Synthetic peptides corresponding to POLR3A(polymerase (RNA) III (DNA directed) polypeptide A, 155kDa) The peptide sequence was selected from the middle region of POLR3A (NP_008986). Peptide sequence AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT. | |
Affinity Purified | |
RUO | |
11128 | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DNA-directed RNA polymerase III largest subunit, DNA-directed RNA polymerase III subunit A, DNA-directed RNA polymerase III subunit RPC1, EC 2.7.7.6, hRPC155, POL3A, polymerase (RNA) III (DNA directed) polypeptide A, 155kDa, RNA polymerase III 155 kDa subunit, RNA polymerase III subunit C160, RNA polymerase III subunit RPC155-D, RPC1, RPC155RNA polymerase III subunit C1 | |
Rabbit | |
156 kDa | |
20 μL | |
Primary | |
This product is specific to Subunit or Isoform: RPC1. | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction