POLR3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15305120UL

Catalog No. NBP1530520

Description

POLR3A Polyclonal specifically detects POLR3A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: POLR3A
• Classification: Polyclonal
• Dilution: Western Blot 0.2-1 ug/ml
• Gene Accession No.: O14802
• Gene Symbols: POLR3A
• Immunogen: Synthetic peptides corresponding to POLR3A(polymerase (RNA) III (DNA directed) polypeptide A, 155kDa) The peptide sequence was selected from the middle region of POLR3A (NP_008986). Peptide sequence AYFGQKDSVCGVSECIIMGIPMNIGTGLFKLLHKADRDPNPPKRPLIFDT.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11128
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DNA-directed RNA polymerase III largest subunit, DNA-directed RNA polymerase III subunit A, DNA-directed RNA polymerase III subunit RPC1, EC 2.7.7.6, hRPC155, POL3A, polymerase (RNA) III (DNA directed) polypeptide A, 155kDa, RNA polymerase III 155 kDa subunit, RNA polymerase III subunit C160, RNA polymerase III subunit RPC155-D, RPC1, RPC155RNA polymerase III subunit C1
• Host Species: Rabbit
• Molecular Weight of Antigen: 156 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: RPC1.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.