Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. POLR3B Antibody, Novus Biologicals™

POLR3B Antibody, Novus Biologicals™
SDP

Catalog No. NBP154363 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP154363 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP154363 Supplier Novus Biologicals Supplier No. NBP154363
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

POLR3B Polyclonal specifically detects POLR3B in Human samples. It is validated for Western Blot.

Specifications

Antigen POLR3B
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NW08
Gene Alias C128, DKFZp686B10117, DNA-directed RNA polymerase III 127.6 kDa polypeptide, DNA-directed RNA polymerase III subunit B, DNA-directed RNA polymerase III subunit RPC2, EC 2.7.7.6, FLJ10388, polymerase (RNA) III (DNA directed) polypeptide B, RNA polymerase III subunit C2, RPC2
Gene Symbols POLR3B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to POLR3B(polymerase (RNA) III (DNA directed) polypeptide B) The peptide sequence was selected from the C terminal of POLR3B. Peptide sequence IEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSRHGQKGVCGLIVPQED.
Molecular Weight of Antigen 128 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55703
Test Specificity This product is specific to Subunit or Isoform: RPC2.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Yeast, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.