Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. POLR3D Antibody, Novus Biologicals™

POLR3D Antibody, Novus Biologicals™
SDP

Catalog No. NB394579 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB394579 25 μL
NBP256240 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB394579 Supplier Novus Biologicals Supplier No. NBP25624025UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 1 publication

POLR3D Polyclonal specifically detects POLR3D in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen POLR3D
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias BN51, BN51 (BHK21) temperature sensitivity complementing, BN51TDNA-directed RNA polymerase III 47 kDa polypeptide, DNA-directed RNA polymerase III subunit D, DNA-directed RNA polymerase III subunit RPC4, polymerase (RNA) III (DNA directed) polypeptide D, 44kDa, Protein BN51, RNA polymerase III 47 kDa subunit, RNA polymerase III subunit C4, RPC4, RPC53 homolog, temperature sensitive complementation, cell cycle specific, tsBN51, TSBN51RPC53
Gene Symbols POLR3D
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DRQREGHGRGRGRPEVIQSHSIFEQGPAEMMKKKGNWDKTVDVSDMGPSHIINIKKEKRETDEE
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 661
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.