POLR3F Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP24732725UL

Catalog No. NB404534

Description

POLR3F Polyclonal specifically detects POLR3F in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: POLR3F
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: DNA-directed RNA polymerase III 39 kDa polypeptide, DNA-directed RNA polymerase III subunit F, DNA-directed RNA polymerase III subunit RPC6, DNA-directed RNA polymerases III 39 kDa polypeptide, polymerase (RNA) III (DNA directed) polypeptide F (39 kDa), polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa, RNA polymerase III 39 kDa subunit, RNA polymerase III C39 subunit, RNA polymerase III subunit C6, RPC39MGC13517, RPC6
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10621
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: POLR3F
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VAINRLLSMGQLDLLRSNTGLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPLTEINK
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only