Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
POLR3F Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | POLR3F |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
POLR3F Polyclonal specifically detects POLR3F in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| POLR3F | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10621 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VAINRLLSMGQLDLLRSNTGLLYRIKDSQNAGKMKGSDNQEKLVYQIIEDAGNKGIWSRDIRYKSNLPLTEINK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| DNA-directed RNA polymerase III 39 kDa polypeptide, DNA-directed RNA polymerase III subunit F, DNA-directed RNA polymerase III subunit RPC6, DNA-directed RNA polymerases III 39 kDa polypeptide, polymerase (RNA) III (DNA directed) polypeptide F (39 kDa), polymerase (RNA) III (DNA directed) polypeptide F, 39 kDa, RNA polymerase III 39 kDa subunit, RNA polymerase III C39 subunit, RNA polymerase III subunit C6, RPC39MGC13517, RPC6 | |
| POLR3F | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title