Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

POLR3H Antibody, Novus Biologicals™
SDP

Catalog No. NBP153025 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP153025 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP153025 Supplier Novus Biologicals Supplier No. NBP153025
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

POLR3H Polyclonal specifically detects POLR3H in Human samples. It is validated for Western Blot.

Specifications

Antigen POLR3H
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. B0QYH9
Gene Alias DNA-directed RNA polymerase III subunit 22.9 kDa polypeptide, DNA-directed RNA polymerase III subunit H, DNA-directed RNA polymerase III subunit RPC8, KIAA1665MGC29654, MGC111097, polymerase (RNA) III (DNA directed) polypeptide H (22.9kD), RNA nucleotidyltransferase (DNA-directed), RNA polymerase III subunit 22.9 kDa subunit, RNA polymerase III subunit C8, RNA polymerase III subunit RPC8, RPC8RPC22.9
Gene Symbols POLR3H
Host Species Rabbit
Immunogen Synthetic peptides corresponding to POLR3H(polymerase (RNA) III (DNA directed) polypeptide H (22.9kD)) The peptide sequence was selected from the middle region of POLR3H. Peptide sequence AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEELPKKEAPYTL.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 171568
Test Specificity This product is specific to Subunit or Isoform: RPC8.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.